missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HARBI1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | HARBI1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HARBI1 Polyclonal specifically detects HARBI1 in Human samples. It is validated for Western Blot.Specifications
| HARBI1 | |
| Polyclonal | |
| Rabbit | |
| Q96MB7 | |
| 283254 | |
| Synthetic peptides corresponding to C11ORF77 The peptide sequence was selected from the middle region of C11ORF77. Peptide sequence GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C11orf77, chromosome 11 open reading frame 77, EC 3.1, FLJ32675, harbinger transposase derived 1, Harbinger transposase-derived nuclease, putative nuclease HARBI1 | |
| HARBI1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title