HARBI1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56801

Product Code. 18254825

Description

HARBI1 Polyclonal specifically detects HARBI1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HARBI1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C11orf77, chromosome 11 open reading frame 77, EC 3.1, FLJ32675, harbinger transposase derived 1, Harbinger transposase-derived nuclease, putative nuclease HARBI1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 283254
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96MB7
• Gene Symbols: HARBI1
• Immunogen: Synthetic peptides corresponding to C11ORF77 The peptide sequence was selected from the middle region of C11ORF77. Peptide sequence GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Rat: 100%; Chicken: 100%; Canine: 100%; Bovine: 100%; Human: 100%; Xenopus: 91%; blue catfish: 85%; Zebrafish: 78%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG