missing translation for 'onlineSavingsMsg'
Learn More
Learn More
-Immunocytochemistry-Immunofluorescence-NBP3-16248-img0002.jpg-650.jpg)
-Immunohistochemistry-Paraffin-NBP3-16248-img0001.jpg-650.jpg)
-Western-Blot-NBP3-16248-img0003.jpg-650.jpg)
Guanylyl Cyclase beta 1 Rabbit anti-Human, Mouse, Rat, Clone: 5O8D9, Novus Biologicals™
Rabbit Monoclonal Antibody
£150.00 - £387.00
Specifications
| Antigen | Guanylyl Cyclase beta 1 |
|---|---|
| Clone | 5O8D9 |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18328126
|
Novus Biologicals
NBP3-16248-20UL |
20 μg |
£150.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18067635
|
Novus Biologicals
NBP3-16248-100UL |
100 μg |
£387.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Guanylyl Cyclase beta 1 Monoclonal antibody specifically detects Guanylyl Cyclase beta 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Guanylyl Cyclase beta 1 | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| EC 4.6.1.2, GC-SB3, GCS-beta-1, GCS-beta-3, guanylate cyclase 1, soluble, beta 3, guanylate cyclase soluble subunit beta-1, Guanylate cyclase soluble subunit beta-3, GUC1B3GUCB3, GUCSB3GC-S-beta-1, GUCY1B1, Soluble guanylate cyclase small subunit | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Guanylyl Cyclase beta 1 (Q02153). MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 5O8D9 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 2983 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title