missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Guanylyl Cyclase beta 1 Rabbit anti-Human, Mouse, Rat, Clone: 5O8D9, Novus Biologicals™

Guanylyl Cyclase beta 1 Rabbit anti-Human, Mouse, Rat, Clone: 5O8D9, Novus Biologicals™

Product Code. 18328126 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18328126 20 μg 20µL
18067635 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18328126 Supplier Novus Biologicals Supplier No. NBP31624820UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Guanylyl Cyclase beta 1 Monoclonal antibody specifically detects Guanylyl Cyclase beta 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Guanylyl Cyclase beta 1
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 5O8D9
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias EC 4.6.1.2, GC-SB3, GCS-beta-1, GCS-beta-3, guanylate cyclase 1, soluble, beta 3, guanylate cyclase soluble subunit beta-1, Guanylate cyclase soluble subunit beta-3, GUC1B3GUCB3, GUCSB3GC-S-beta-1, GUCY1B1, Soluble guanylate cyclase small subunit
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Guanylyl Cyclase beta 1 (Q02153). MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQN
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 2983
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.