GTPBP9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-89725

Product Code. 18412091

Description

GTPBP9 Polyclonal antibody specifically detects GTPBP9 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown

Specifications

• Antigen: GTPBP9
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
• Gene Alias: DKFZp313H1942, DNA damage-regulated overexpressed in cancer 45 protein, DOC45, EC 3.6.3, EC 3.6.3.-, GBP45, GTP-binding protein 9, GTP-binding protein 9 (putative), GTP-binding protein PTD004, GTPBP9, homologous yeast-44.2 protein, Obg-like ATPase 1, PTD004
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFED
• Quantity: 0.1 mL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 29789
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin), KnockDown
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified