missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GTPBP9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | GTPBP9 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
GTPBP9 Polyclonal specifically detects GTPBP9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GTPBP9 | |
| Polyclonal | |
| Purified | |
| RUO | |
| DKFZp313H1942, DNA damage-regulated overexpressed in cancer 45 protein, DOC45, EC 3.6.3, EC 3.6.3.-, GBP45, GTP-binding protein 9, GTP-binding protein 9 (putative), GTP-binding protein PTD004, GTPBP9, homologous yeast-44.2 protein, Obg-like ATPase 1, PTD004 | |
| OLA1 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Q9NTK5 | |
| 29789 | |
| Synthetic peptides corresponding to GTPBP9 (GTP-binding protein 9 (putative)) The peptide sequence was selected from the N terminal of GTPBP9. Peptide sequence MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title