missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GTPBP10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | GTPBP10 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GTPBP10 Polyclonal specifically detects GTPBP10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GTPBP10 | |
| Polyclonal | |
| Rabbit | |
| A4D1E9 | |
| 85865 | |
| Synthetic peptides corresponding to GTPBP10(GTP-binding protein 10 (putative)) The peptide sequence was selected from the middle region of GTPBP10. Peptide sequence IILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFL. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| DKFZP686A10121, FLJ38242, GTP-binding protein 10, GTP-binding protein 10 (putative), MGC104191, ObgH2, Protein obg homolog 2 | |
| GTPBP10 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title