missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GTP binding protein era homolog Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | GTP binding protein era homolog |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GTP binding protein era homolog Polyclonal specifically detects GTP binding protein era homolog in Human samples. It is validated for Western Blot.Specifications
| GTP binding protein era homolog | |
| Polyclonal | |
| Rabbit | |
| O75616 | |
| 26284 | |
| Synthetic peptides corresponding to ERAL1(Era G-protein-like 1 (E. coli)) The peptide sequence was selected from the middle region of ERAL1. Peptide sequence KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CEGA, Conserved ERA-like GTPase, ERA, Era (E. coli G-protein homolog)-like 1, Era G-protein-like 1 (E. coli), ERAL1A, ERA-like protein 1, ERA-W, GTPase Era, mitochondrial, GTPase, human homolog of E. coli essential cell cycle protein Era, GTP-binding protein era homolog, HERA, H-ERA, HERA-A, HERA-B | |
| ERAL1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title