missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GTP binding protein era homolog Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57493
This item is not returnable.
View return policy
Description
GTP binding protein era homolog Polyclonal specifically detects GTP binding protein era homolog in Human samples. It is validated for Western Blot.
Specifications
| GTP binding protein era homolog | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CEGA, Conserved ERA-like GTPase, ERA, Era (E. coli G-protein homolog)-like 1, Era G-protein-like 1 (E. coli), ERAL1A, ERA-like protein 1, ERA-W, GTPase Era, mitochondrial, GTPase, human homolog of E. coli essential cell cycle protein Era, GTP-binding protein era homolog, HERA, H-ERA, HERA-A, HERA-B | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 26284 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| O75616 | |
| ERAL1 | |
| Synthetic peptides corresponding to ERAL1(Era G-protein-like 1 (E. coli)) The peptide sequence was selected from the middle region of ERAL1. Peptide sequence KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Bovine: 85%; Canine: 85%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction