missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GSTZ1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | GSTZ1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
GSTZ1 Polyclonal specifically detects GSTZ1 in Human samples. It is validated for Western Blot.Specifications
| GSTZ1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| EC 2.5.1.18, EC 5.2.1.2, glutathione S-alkyltransferase, glutathione S-aralkyltransferase, Glutathione S-transferase zeta 1, glutathione transferase zeta 1, GSTZ1-1maleylacetoacetate isomerase, MAAIglutathione S-aryltransferase, MAI, maleylacetone isomerase, MGC2029, S-(hydroxyalkyl)glutathione lyase | |
| GSTZ1 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| O43708 | |
| 2954 | |
| Synthetic peptides corresponding to GSTZ1(glutathione transferase zeta 1 (maleylacetoacetate isomerase)) The peptide sequence was selected from the N terminal of GSTZ1. Peptide sequence MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF. | |
| Primary | |
| 24 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title