missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GSTZ1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-55137
This item is not returnable.
View return policy
Description
GSTZ1 Polyclonal specifically detects GSTZ1 in Human samples. It is validated for Western Blot.
Specifications
| GSTZ1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EC 2.5.1.18, EC 5.2.1.2, glutathione S-alkyltransferase, glutathione S-aralkyltransferase, Glutathione S-transferase zeta 1, glutathione transferase zeta 1, GSTZ1-1maleylacetoacetate isomerase, MAAIglutathione S-aryltransferase, MAI, maleylacetone isomerase, MGC2029, S-(hydroxyalkyl)glutathione lyase | |
| Rabbit | |
| 24 kDa | |
| 100 μL | |
| metabolism | |
| 2954 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| O43708 | |
| GSTZ1 | |
| Synthetic peptides corresponding to GSTZ1(glutathione transferase zeta 1 (maleylacetoacetate isomerase)) The peptide sequence was selected from the N terminal of GSTZ1. Peptide sequence MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF. | |
| Protein A purified | |
| RUO | |
| Primary | |
| Goat: 77%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction