missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPRASP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | GPRASP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GPRASP2 Polyclonal specifically detects GPRASP2 in Human samples. It is validated for Western Blot.Specifications
| GPRASP2 | |
| Polyclonal | |
| Rabbit | |
| Q96D09 | |
| 114928 | |
| Synthetic peptides corresponding to GPRASP2(G protein-coupled receptor associated sorting protein 2) The peptide sequence was selected from the middle region of GPRASP2. Peptide sequence EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ35662, FLJ37327, G protein-coupled receptor associated sorting protein 2, GASP2, GASP-2, G-protein coupled receptor-associated sorting protein 2 | |
| GPRASP2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title