GPRASP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56710

Product Code. 18262781

Description

GPRASP2 Polyclonal specifically detects GPRASP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GPRASP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ35662, FLJ37327, G protein-coupled receptor associated sorting protein 2, GASP2, GASP-2, G-protein coupled receptor-associated sorting protein 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114928
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96D09
• Gene Symbols: GPRASP2
• Immunogen: Synthetic peptides corresponding to GPRASP2(G protein-coupled receptor associated sorting protein 2) The peptide sequence was selected from the middle region of GPRASP2. Peptide sequence EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Pig: 100%; Canine: 92%; Equine: 91%; Guinea pig: 90%; Rat: 84%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG