GPR154 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18492892	Novus Biologicals NBP1-91966-25ul	25 μL

Description

GPR154 Polyclonal specifically detects GPR154 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GPR154
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q6W5P4
• Gene ID (Entrez): 387129
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQILSKP
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: GPCR
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: G protein-coupled receptor 154, G protein-coupled receptor for asthma susceptibility, GPR154NPSR, GPRAASRT2, G-protein coupled receptor 154, G-protein coupled receptor for asthma susceptibility, G-protein coupled receptor PGR14, neuropeptide S receptor, neuropeptide S receptor 1, PGR14VRR1, vasopressin receptor-related receptor 1
• Gene Symbols: NPSR1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only