missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GOLGA7B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | GOLGA7B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GOLGA7B Polyclonal specifically detects GOLGA7B in Human samples. It is validated for Western Blot.Specifications
| GOLGA7B | |
| Polyclonal | |
| Rabbit | |
| Q2TAP0 | |
| 401647 | |
| Synthetic peptides corresponding to C10ORF132 The peptide sequence was selected from the N terminal of C10ORF132. Peptide sequence MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| bA451M19.3, bA459F3.4, C10orf132, C10orf133, chromosome 10 open reading frame 132, chromosome 10 open reading frame 133, golgi autoantigen, golgin subfamily a, 7B, golgin A7 family, member B, Golgin subfamily A member 7B, MGC131701 | |
| GOLGA7B | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title