missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GOLGA7B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-56754
This item is not returnable.
View return policy
Description
GOLGA7B Polyclonal specifically detects GOLGA7B in Human samples. It is validated for Western Blot.
Specifications
| GOLGA7B | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| bA451M19.3, bA459F3.4, C10orf132, C10orf133, chromosome 10 open reading frame 132, chromosome 10 open reading frame 133, golgi autoantigen, golgin subfamily a, 7B, golgin A7 family, member B, Golgin subfamily A member 7B, MGC131701 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 401647 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q2TAP0 | |
| GOLGA7B | |
| Synthetic peptides corresponding to C10ORF132 The peptide sequence was selected from the N terminal of C10ORF132. Peptide sequence MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Mouse: 100%; Human: 100%; Zebrafish: 92%; Green puffer: 85%; Southern house mosquito: 78%; Florida lancelet: 78%; Yellowfever mosquito: 78%;. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction