missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GOLGA5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | GOLGA5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GOLGA5 Polyclonal specifically detects GOLGA5 in Human samples. It is validated for Western Blot.Specifications
| GOLGA5 | |
| Polyclonal | |
| Rabbit | |
| Golgi Apparatus Markers | |
| Cell proliferation-inducing gene 31 protein, golgi autoantigen, golgin subfamily a, 5, golgin A5, Golgin subfamily A member 5, Golgin-84, GOLIM5, Protein Ret-II, PTC5, RET-fused gene 5 protein, ret-II, RETII, rfg5, RFG5golgi integral membrane protein 5 | |
| GOLGA5 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TBA6 | |
| 9950 | |
| Synthetic peptides corresponding to GOLGA5(golgi autoantigen, golgin subfamily a, 5) The peptide sequence was selected from the N terminal of GOLGA5. Peptide sequence FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title