missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glutamate Dehydrogenase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | Glutamate Dehydrogenase |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18271352
|
Novus Biologicals
NBP2-57114 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18640828
|
Novus Biologicals
NBP2-57114-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Glutamate Dehydrogenase Polyclonal specifically detects Glutamate Dehydrogenase in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Glutamate Dehydrogenase | |
| Polyclonal | |
| Rabbit | |
| Cellular Markers, Diabetes Research, Mitochondrial Markers, Neuroscience | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2746 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 1.4.1, EC 1.4.1.3, GDH, GDH 1, GDH1, GLUD, glutamate dehydrogenase (NAD(P)+), glutamate dehydrogenase 1, glutamate dehydrogenase 1, mitochondrial, MGC132003 | |
| GLUD1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title