Glutamate Dehydrogenase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque:  Novus Biologicals NBP2-57114-25ul

Code produit. 18640828

Description

Glutamate Dehydrogenase Polyclonal specifically detects Glutamate Dehydrogenase in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Spécification

• Antigen: Glutamate Dehydrogenase
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: EC 1.4.1, EC 1.4.1.3, GDH, GDH 1, GDH1, GLUD, glutamate dehydrogenase (NAD(P)+), glutamate dehydrogenase 1, glutamate dehydrogenase 1, mitochondrial, MGC132003
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: GLUD1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDK
• Quantity: 25 μL
• Research Discipline: Cellular Markers, Diabetes Research, Mitochondrial Markers, Neuroscience
• Gene ID (Entrez): 2746
• Target Species: Human
• Form: Purified

For Research Use Only