missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GLUT12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-60023
This item is not returnable.
View return policy
Description
GLUT12 Polyclonal specifically detects GLUT12 in Human samples. It is validated for Western Blot.
Specifications
| GLUT12 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| GLUT-12, GLUT12GLUT8Glucose transporter type 12, solute carrier family 2 (facilitated glucose transporter), member 12, solute carrier family 2, facilitated glucose transporter member 12 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 154091 | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8TD20 | |
| SLC2A12 | |
| Synthetic peptides corresponding to SLC2A12(solute carrier family 2 (facilitated glucose transporter), member 12) The peptide sequence was selected from the middle region of SLC2A12. Peptide sequence FFVQITGQPNILFYASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATL The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction