missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glucose 1-dehydrogenase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Glucose 1-dehydrogenase |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
Glucose 1-dehydrogenase Polyclonal specifically detects Glucose 1-dehydrogenase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Glucose 1-dehydrogenase | |
| Unconjugated | |
| RUO | |
| 6-phosphogluconolactonase, DKFZp686A01246, EC 1.1.1.49, EC 2.7.4.3, EC 3.1.1.31, G6PD, H form, G6PDH, GDH/6PGL endoplasmic bifunctional protein, GDHglucose 1- dehydrogenase, glucose dehydrogenase, glucose dehyrogenase, glucose-6-phosphate dehydrogenase, salivary, hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase), MGC87643 | |
| H6PD | |
| IgG |
| Polyclonal | |
| Rabbit | |
| O95479 | |
| 9563 | |
| Synthetic peptides corresponding to H6PD(hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) The peptide sequence was selected from the N terminal of H6PD. Peptide sequence HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title