missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glucose 1-dehydrogenase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57903
This item is not returnable.
View return policy
Description
Glucose 1-dehydrogenase Polyclonal specifically detects Glucose 1-dehydrogenase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Glucose 1-dehydrogenase | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 6-phosphogluconolactonase, DKFZp686A01246, EC 1.1.1.49, EC 2.7.4.3, EC 3.1.1.31, G6PD, H form, G6PDH, GDH/6PGL endoplasmic bifunctional protein, GDHglucose 1- dehydrogenase, glucose dehydrogenase, glucose dehyrogenase, glucose-6-phosphate dehydrogenase, salivary, hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase), MGC87643 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 9563 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin | |
| O95479 | |
| H6PD | |
| Synthetic peptides corresponding to H6PD(hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) The peptide sequence was selected from the N terminal of H6PD. Peptide sequence HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Equine: 92%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction