missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
GLTSCR1 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£165.00 - £360.00
Tekniske data
| Antigen | GLTSCR1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|
18027244
|
Novus Biologicals
NBP3-09493-25UL |
25 μg |
£165.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18084376
|
Novus Biologicals
NBP3-09493-100UL |
100 μg |
£360.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
GLTSCR1 Polyclonal specifically detects GLTSCR1 in Human, Mouse samples. It is validated for Western Blot.Tekniske data
| GLTSCR1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| Glioma Tumor Suppressor Candidate Region Gene 1, Glioma Tumor Suppressor Candidate Region Gene 1 Protein | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Gltscr1 (NP_001074887). Peptide sequence FIQEEKTTLALDKQLAKEKPDEYVSSSRSLGFPVPVSSEGHRLPSHGQSS | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 29998 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel