missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GJC3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£361.00
Specifications
| Antigen | GJC3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
GJC3 Polyclonal specifically detects GJC3 in Human samples. It is validated for Western Blot.Specifications
| GJC3 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q8NFK1 | |
| 349149 | |
| Synthetic peptides corresponding to GJC3 The peptide sequence was selected from the C terminal of GJC3. Peptide sequence KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| connexin 29, connexin-30.2, Connexin-31.3, CX29, Cx30.2, CX30.2connexin-31.3, CX31.3, Gap junction epsilon-1 protein, gap junction gamma-3 protein, gap junction protein, epsilon 1, 29kDa, gap junction protein, gamma 3, 30.2kDa, GJE1 | |
| GJC3 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title