GJC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59162

Product Code. 18245293

Description

GJC3 Polyclonal specifically detects GJC3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GJC3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: connexin 29, connexin-30.2, Connexin-31.3, CX29, Cx30.2, CX30.2connexin-31.3, CX31.3, Gap junction epsilon-1 protein, gap junction gamma-3 protein, gap junction protein, epsilon 1, 29kDa, gap junction protein, gamma 3, 30.2kDa, GJE1
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 349149
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NFK1
• Gene Symbols: GJC3
• Immunogen: Synthetic peptides corresponding to GJC3 The peptide sequence was selected from the C terminal of GJC3. Peptide sequence KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%;.
• Target Species: Human
• Form: Purified