GIPC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18462892	Novus Biologicals NBP1-91941-25ul	25 μL

Description

GIPC1 Polyclonal specifically detects GIPC1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GIPC1
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: C19orf3chromosome 19 open reading frame 3, GAIP C-terminus-interacting protein, GIPC PDZ domain containing family, member 1, GIPCRGS-GAIP-interacting protein, GLUT1 C-terminal binding protein, GLUT1CBP, IGF-1 receptor interacting protein 1, MGC15889, MGC3774, NIP, PDZ domain-containing protein GIPC1, regulator of G-protein signalling 19 interacting protein 1, RGS19IP1IIP-1, SEMCAP, SYNECTIIN, SYNECTIN, Tax interaction protein 2, TIP-2RGS19-interacting protein 1
• Gene Symbols: GIPC1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 10755
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGR
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only