missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GIPC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-91941-25ul
This item is not returnable.
View return policy
Description
GIPC1 Polyclonal specifically detects GIPC1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| GIPC1 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| C19orf3chromosome 19 open reading frame 3, GAIP C-terminus-interacting protein, GIPC PDZ domain containing family, member 1, GIPCRGS-GAIP-interacting protein, GLUT1 C-terminal binding protein, GLUT1CBP, IGF-1 receptor interacting protein 1, MGC15889, MGC3774, NIP, PDZ domain-containing protein GIPC1, regulator of G-protein signalling 19 interacting protein 1, RGS19IP1IIP-1, SEMCAP, SYNECTIIN, SYNECTIN, Tax interaction protein 2, TIP-2RGS19-interacting protein 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| GIPC1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGR | |
| 25 μL | |
| Signal Transduction | |
| 10755 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur