missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GIMAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | GIMAP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GIMAP1 Polyclonal specifically detects GIMAP1 in Human samples. It is validated for Western Blot.Specifications
| GIMAP1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| GTPase IMAP family member 1, GTPase, IMAP family member 1, HIMAP1, IMAP1immunity associated protein 1, IMAP38, Immunity-associated protein 1 | |
| GIMAP1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8WWP7 | |
| 170575 | |
| Synthetic peptides corresponding to GIMAP1(GTPase, IMAP family member 1) The peptide sequence was selected from the N terminal of GIMAP1. Peptide sequence MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title