GIMAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59488

Product Code. 18283913

Description

GIMAP1 Polyclonal specifically detects GIMAP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GIMAP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GTPase IMAP family member 1, GTPase, IMAP family member 1, HIMAP1, IMAP1immunity associated protein 1, IMAP38, Immunity-associated protein 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 170575
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8WWP7
• Gene Symbols: GIMAP1
• Immunogen: Synthetic peptides corresponding to GIMAP1(GTPase, IMAP family member 1) The peptide sequence was selected from the N terminal of GIMAP1. Peptide sequence MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%;.
• Target Species: Human
• Isotype: IgG