missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Gemin 7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | Gemin 7 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|
18262895
|
Novus Biologicals
NBP2-58154 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18691969
|
Novus Biologicals
NBP2-58154-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
Gemin 7 Polyclonal specifically detects Gemin 7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
| Gemin 7 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 79760 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| FLJ13956, gem (nuclear organelle) associated protein 7, gem-associated protein 7, gemin 7, Gemin-7, SIP3 | |
| GEMIN7 | |
| IgG | |
| Affinity Purified |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto