missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GDC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£376.00
Specifications
| Antigen | GDC |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18259422
|
Novus Biologicals
NBP1-59587 |
100 μL | |||||||
Description
GDC Polyclonal specifically detects GDC in Human samples. It is validated for Western Blot.Specifications
| GDC | |
| Polyclonal | |
| Purified | |
| RUO | |
| D10S105EGDC, GDASolute carrier family 25 member 16, Graves disease autoantigen, graves disease carrier protein, HGT.1, hML7, member 16, MGC39851, Mitochondrial solute carrier protein homolog, ML7, solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen) | |
| SLC25A16 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| P16260 | |
| 8034 | |
| Synthetic peptides corresponding to SLC25A16(solute carrier family 25, member 16) The peptide sequence was selected from the N terminal of SLC25A16. Peptide sequence KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title