missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GDC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59587
This item is not returnable.
View return policy
Description
GDC Polyclonal specifically detects GDC in Human samples. It is validated for Western Blot.
Specifications
| GDC | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| D10S105EGDC, GDASolute carrier family 25 member 16, Graves disease autoantigen, graves disease carrier protein, HGT.1, hML7, member 16, MGC39851, Mitochondrial solute carrier protein homolog, ML7, solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen) | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 8034 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P16260 | |
| SLC25A16 | |
| Synthetic peptides corresponding to SLC25A16(solute carrier family 25, member 16) The peptide sequence was selected from the N terminal of SLC25A16. Peptide sequence KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; Zebrafish: 84%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Yeast, Zebrafish | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction