GDC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59587

Product Code. 18259422

Description

GDC Polyclonal specifically detects GDC in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GDC
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: D10S105EGDC, GDASolute carrier family 25 member 16, Graves disease autoantigen, graves disease carrier protein, HGT.1, hML7, member 16, MGC39851, Mitochondrial solute carrier protein homolog, ML7, solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen)
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8034
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P16260
• Gene Symbols: SLC25A16
• Immunogen: Synthetic peptides corresponding to SLC25A16(solute carrier family 25, member 16) The peptide sequence was selected from the N terminal of SLC25A16. Peptide sequence KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; Zebrafish: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Yeast, Zebrafish
• Form: Purified