missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GCOM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | GCOM1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GCOM1 Polyclonal specifically detects GCOM1 in Human samples. It is validated for Western Blot.Specifications
| GCOM1 | |
| Polyclonal | |
| Rabbit | |
| Gcom, GRINL1A combined protein, GRINL1A upstream protein, Gup | |
| GCOM1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 145781 | |
| Synthetic peptides corresponding to GCOM1 The peptide sequence was selected from the middle region of GCOM1. Peptide sequence VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title