GCOM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56359

Product Code. 18258422

Description

GCOM1 Polyclonal specifically detects GCOM1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GCOM1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: GCOM1
• Immunogen: Synthetic peptides corresponding to GCOM1 The peptide sequence was selected from the middle region of GCOM1. Peptide sequence VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 92%; Mouse: 92%; Rat: 92%; Rabbit: 85%; Bovine: 84%; Equine: 84%; Pig: 78%; Canine: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: Gcom, GRINL1A combined protein, GRINL1A upstream protein, Gup
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 145781
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.