GBX1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-91420

Product Code. 18331811

Description

GBX1 Polyclonal specifically detects GBX1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GBX1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: gastrulation brain homeo box 1, gastrulation brain homeobox 1, homeobox protein GBX-1
• Host Species: Rabbit
• Molecular Weight of Antigen: 40 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Fruit fly: 100%; Medaka fish: 100%; Green puffer: 100%; Body louse: 100%; Red flour beetle: 100%; African malaria mosquito: 92%; Western clawed frog: 92%; Florida lancelet: 92%; Yellowfever mosquito: 92%; Common carp: 92%; Mosquito: 92%; Xenopus: 92%; Southern house mosquito: 92%; Common lancelet: 91%; Budgerigar: 85%; Bovine: 85%; Canine: 85%; Dumeril's clam worm: 85%; Bobwhite quail: 85%; Bornean orangutan: 85%; Chimpanzee: 85%; Pig-tailed macaque: 85%; Common woolly monkey: 85%; Black-handed spider monkey: 85%; Pygmy chimpanzee: 85%; Western Gorilla: 78%; Gibbula varia: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001092304
• Gene Symbols: GBX1
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GBX1. Peptide Sequence AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP. The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2636
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.