missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GAS8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | GAS8 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
GAS8 Polyclonal specifically detects GAS8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| GAS8 | |
| Unconjugated | |
| RUO | |
| GAS-11, GAS11MGC138326, GAS-8, growth arrest specific 11, growth arrest-specific 11, growth arrest-specific 8, Growth arrest-specific protein 11, growth arrest-specific protein 8 | |
| GAS8 | |
| IgG | |
| 56 kDa |
| Polyclonal | |
| Rabbit | |
| O95995 | |
| 2622 | |
| Synthetic peptides corresponding to GAS8(growth arrest-specific 8) The peptide sequence was selected from the middle region of GAS8. Peptide sequence RALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title