GAS8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55508

Product Code. 18285003

Description

GAS8 Polyclonal specifically detects GAS8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GAS8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GAS-11, GAS11MGC138326, GAS-8, growth arrest specific 11, growth arrest-specific 11, growth arrest-specific 8, Growth arrest-specific protein 11, growth arrest-specific protein 8
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 : 1200, Immunohistochemistry-Paraffin
• Gene Accession No.: O95995
• Gene Symbols: GAS8
• Immunogen: Synthetic peptides corresponding to GAS8(growth arrest-specific 8) The peptide sequence was selected from the middle region of GAS8. Peptide sequence RALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2622
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG