missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GAMT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | GAMT |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
GAMT Polyclonal specifically detects GAMT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GAMT | |
| Unconjugated | |
| RUO | |
| A8K0A0 | |
| 2593 | |
| Synthetic peptides corresponding to GAMT(guanidinoacetate N-methyltransferase) The peptide sequence was selected from the middle region of GAMT. Peptide sequence PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Human | |
| EC 2.1.1.2, guanidinoacetate N-methyltransferase, PIG2, TP53I2 | |
| GAMT | |
| IgG | |
| 29 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title