missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GAGE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £460.00
Specifications
| Antigen | GAGE1 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18128109
|
Novus Biologicals
NBP2-54704 |
100 μL |
£460.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18687777
|
Novus Biologicals
NBP2-54704-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GAGE1 Polyclonal specifically detects GAGE1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GAGE1 | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 2543 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:PPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| Antigen MZ2-F, Cancer/testis antigen 4.1, G antigen 1, GAGE-1, member 1, MGC33825, MZ2-F antigen | |
| GAGE1 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title