missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GAGE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-54704-25ul
This item is not returnable.
View return policy
Description
GAGE1 Polyclonal specifically detects GAGE1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| GAGE1 | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Antigen MZ2-F, Cancer/testis antigen 4.1, G antigen 1, GAGE-1, member 1, MGC33825, MZ2-F antigen | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| GAGE1 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:PPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAA | |
| 25 μL | |
| Cancer | |
| 2543 | |
| Human |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction