missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GABA-A R rho 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | GABA-A R rho 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GABA-A R rho 1 Polyclonal specifically detects GABA-A R rho 1 in Human samples. It is validated for Western Blot.Specifications
| GABA-A R rho 1 | |
| Polyclonal | |
| Rabbit | |
| NP_002033 | |
| 2569 | |
| Synthetic peptide directed towards the N terminal of human GABRR1. Peptide sequence MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| GABA(C) receptor, gamma-aminobutyric acid (GABA) A receptor, rho-1, gamma-aminobutyric acid (GABA) receptor, rho 1, gamma-aminobutyric acid receptor subunit rho-1, rho 1) | |
| GABRR1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title