missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GABA-A R rho 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79971
This item is not returnable.
View return policy
Description
GABA-A R rho 1 Polyclonal specifically detects GABA-A R rho 1 in Human samples. It is validated for Western Blot.
Specifications
| GABA-A R rho 1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| GABA(C) receptor, gamma-aminobutyric acid (GABA) A receptor, rho-1, gamma-aminobutyric acid (GABA) receptor, rho 1, gamma-aminobutyric acid receptor subunit rho-1, rho 1) | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 2569 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_002033 | |
| GABRR1 | |
| Synthetic peptide directed towards the N terminal of human GABRR1. Peptide sequence MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 86%; Rat: 86%. | |
| Human, Rat, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction