missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GABA-A R gamma 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £587.00
Specifications
| Antigen | GABA-A R gamma 1 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18323553
|
Bio-Techne
NBP3-17492-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18305312
|
Novus Biologicals
NBP3-17492-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
GABA-A R gamma 1 Polyclonal antibody specifically detects GABA-A R gamma 1 in Human samples. It is validated for ImmunofluorescenceSpezifikation
| GABA-A R gamma 1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Stem Cell Markers | |
| PBS, pH 7.2, 40% glycerol | |
| 2565 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| DKFZp686H2042, GABA(A) receptor subunit gamma-1, gamma-1 polypeptide, gamma-aminobutyric acid (GABA) A receptor, gamma 1, gamma-aminobutyric acid receptor subunit gamma-1, MGC33838 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: NKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDC | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts