missing translation for 'onlineSavingsMsg'
Learn More
Learn More
G protein beta 4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | G protein beta 4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
G protein beta 4 Polyclonal specifically detects G protein beta 4 in Human samples. It is validated for Western Blot.Specifications
| G protein beta 4 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| G protein beta-4 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 4, guanine nucleotide binding protein beta subunit 4, guanine nucleotide-binding protein subunit beta-4, Transducin beta chain 4 | |
| GNB4 | |
| IgG | |
| 37 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_067642 | |
| 59345 | |
| Synthetic peptide directed towards the middle region of human GNB4. Peptide sequence DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title