G protein beta 4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79681

Product Code. 18259855

Description

G protein beta 4 Polyclonal specifically detects G protein beta 4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: G protein beta 4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: G protein beta-4 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 4, guanine nucleotide binding protein beta subunit 4, guanine nucleotide-binding protein subunit beta-4, Transducin beta chain 4
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 59345
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_067642
• Gene Symbols: GNB4
• Immunogen: Synthetic peptide directed towards the middle region of human GNB4. Peptide sequence DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.