missing translation for 'onlineSavingsMsg'
Learn More
Learn More
G protein alpha 12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | G protein alpha 12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
G protein alpha 12 Polyclonal specifically detects G protein alpha 12 in Human samples. It is validated for Western Blot.Specifications
| G protein alpha 12 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| G alpha-12, gep, G-protein subunit alpha-12, guanine nucleotide binding protein (G protein) alpha 12, guanine nucleotide-binding protein subunit alpha-12, MGC104623, MGC99644, NNX3, RMP, WUGSC:H_GS165O14.2 | |
| GNA12 | |
| IgG | |
| This product is specific to Subunit or Isoform: alpha-12. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q03113 | |
| 2768 | |
| Synthetic peptides corresponding to GNA12(guanine nucleotide binding protein (G protein) alpha 12) The peptide sequence was selected from the middle region of GNA12. Peptide sequence TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF. | |
| Primary | |
| 44 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title