G protein alpha 12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55321

Product Code. 18259002

Description

G protein alpha 12 Polyclonal specifically detects G protein alpha 12 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: G protein alpha 12
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: G alpha-12, gep, G-protein subunit alpha-12, guanine nucleotide binding protein (G protein) alpha 12, guanine nucleotide-binding protein subunit alpha-12, MGC104623, MGC99644, NNX3, RMP, WUGSC:H_GS165O14.2
• Host Species: Rabbit
• Molecular Weight of Antigen: 44 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 2768
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q03113
• Gene Symbols: GNA12
• Immunogen: Synthetic peptides corresponding to GNA12(guanine nucleotide binding protein (G protein) alpha 12) The peptide sequence was selected from the middle region of GNA12. Peptide sequence TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha-12.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG