missing translation for 'onlineSavingsMsg'
Learn More
Learn More
G gamma14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | G gamma14 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18205671
|
Novus Biologicals
NBP2-58646 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18669057
|
Novus Biologicals
NBP2-58646-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
G gamma14 Polyclonal specifically detects G gamma14 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| G gamma14 | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 2793 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| G protein cone gamma 8 subunit, gamma-T2 subunit, G-GAMMA-8, G-gamma-9, G-GAMMA-C, GNG8, GNG9G gamma-C, GNGT8, guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 2, guanine nucleotide binding protein gamma 9, Guanine nucleotide binding protein gamma transducing activity polypeptide 2, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 | |
| GNGT2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title