G gamma14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58646-25ul

Product Code. 18669057

Description

G gamma14 Polyclonal specifically detects G gamma14 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: G gamma14
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: G protein cone gamma 8 subunit, gamma-T2 subunit, G-GAMMA-8, G-gamma-9, G-GAMMA-C, GNG8, GNG9G gamma-C, GNGT8, guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 2, guanine nucleotide binding protein gamma 9, Guanine nucleotide binding protein gamma transducing activity polypeptide 2, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GNGT2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDP
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 2793
• Target Species: Human
• Isotype: IgG

For Research Use Only