missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FYTTD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FYTTD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FYTTD1 Polyclonal specifically detects FYTTD1 in Human samples. It is validated for Western Blot.Specifications
| FYTTD1 | |
| Polyclonal | |
| Rabbit | |
| forty-two-three domain containing 1, Forty-two-three domain-containing protein 1, Protein 40-2-3, UAP56-interacting factor, UIFDKFZp761B1514 | |
| FYTTD1 | |
| IgG | |
| 25 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 84248 | |
| Synthetic peptides corresponding to the middle region of FYTTD1. Immunizing peptide sequence PSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title